Varför välja oss?

Vi har etablerat ett strikt ledningssystem för kvalitet, miljö och arbetsmiljö och har erhållit ISO9001:2015 kvalitetsledningssystemcertifiering, ISO14001:2015 miljöledningssystemcertifiering, GB/T 2601-2003 ledningssystem för arbetsmiljö och säkerhet.Dessutom har vi fått certifikatet "Behåll kontraktet och pålitligt" tilldelat av China Association for Quality Inspection, och vår produkt har tilldelats titeln "China Green Environment products" sex gånger i rad.,
På grundval av att konsolidera den inhemska marknaden exporteras våra produkter och tjänster till mer än tio länder och regioner i Asien, Europa och Afrika, vilket ger kunderna högkvalitativa, effektiva och tillfredsställande tjänster.
Vi har förbundit oss att bli ledaren för läktarens sittindustri i Kina!

Kategori

Fyra kategorier produkter, rika på kategoriserier.
1. Fasta läktare
2. Teleskopiska läktare (infällbara läktare)
3. Bärbara läktare i aluminium
4. Metall strukturella läktare

Patent

150+ patent för produktinnovation och teknologi.

FoU-team

10+ års erfarna teknikerteam.

Marknadsföra

Internationell utveckling och global varumärkesstrategi, säljer bra i 100+ länder och regioner.

Garanti

12 månaders kvalitetsgaranti.

Certifiering

100+ Certifiering inkluderar CE, TUV, SGS, ISO:9001, ISO:14001 etc.

Kvalitetsgaranti

Strikt följa ISO:9001 systematiserad standard.

Produktionslinje

Avancerade produktionslinjer för att säkerställa hög kapacitet och hög effektivitet.

Stöd

Professionell lösningssupport, support för varumärkesfrämjande, anpassad designsupport, bra eftermarknadsservice och teknisk support.

Våra recensioner